PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 200aa    MW: 22994.2 Da    PI: 9.7788
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042561genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv +++++G ++W++ ++  g+ R++k+c++rw +yl
      Lus10042561 14 KGPWTPEEDEILVSYIRRYGHNNWRALPKLAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.71.9e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T eE+e++++++++lG++ W++ a++++ gRt++++k++w++
      Lus10042561  67 RGNFTGEEEEIILKLHQMLGNR-WSAMAAKLP-GRTDNEIKNYWHS 110
                      89********************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.548965IPR017930Myb domain
SuperFamilySSF466892.56E-3110108IPR009057Homeodomain-like
SMARTSM007174.9E-151363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-251568IPR009057Homeodomain-like
CDDcd001671.08E-111661No hitNo description
PROSITE profilePS5129419.03966116IPR017930Myb domain
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002491.4E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2669115IPR009057Homeodomain-like
CDDcd001673.26E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MVRNPSCERM GVKKGPWTPE EDEILVSYIR RYGHNNWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TGEEEEIILK LHQMLGNRWS AMAAKLPGRT DNEIKNYWHS RLKKRCQHDR  120
RSSSCNDMTI LTWTASSCSS SLQGLVEQKS STGDRKERAQ GFDDSSGANG DMKFWYDLFM  180
KAQDSKVQPY KDETANLAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574810.11e-74PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-66MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLI1JB853e-72I1JB85_SOYBN; Uncharacterized protein
STRINGGLYMA02G00820.19e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-68myb domain protein 14